Web Analysis for Coolsailing - coolsailing.com
Coolsailing spécialiste de la location bateau, catamarans, voiliers, location bateaux moteur ou encore Yachts. Depuis 1998 nous proposons tout type de location de bateaux.
4.23
Rating by CuteStat
coolsailing.com is 2 decades 5 years old. It is a domain having com extension. It has a global traffic rank of #8708697 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, coolsailing.com is SAFE to browse.
PageSpeed Score
69
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | 97 |
Daily Pageviews: | 194 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | 3,290 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 13,400 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 8,708,697 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 11 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Fri, 20 Dec 2019 04:48:40 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-Cool-Cache: Fetch: Hit; route=home
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 20251
Content-Type: text/html; charset=UTF-8
Strict-Transport-Security: max-age=16000000; includeSubDomains; preload;
X-XSS-Protection: : 1;mode=block
X-Content-Type-Options: : nosniff
X-Frame-Options: SAMEORIGIN
Date: Fri, 20 Dec 2019 04:48:40 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-Cool-Cache: Fetch: Hit; route=home
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 20251
Content-Type: text/html; charset=UTF-8
Strict-Transport-Security: max-age=16000000; includeSubDomains; preload;
X-XSS-Protection: : 1;mode=block
X-Content-Type-Options: : nosniff
X-Frame-Options: SAMEORIGIN
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dora.ns.cloudflare.com | 172.64.32.108 | United States of America | |
ernest.ns.cloudflare.com | 173.245.59.164 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
coolsailing.com | A | 299 |
IP: 185.123.26.165 |
coolsailing.com | NS | 8879 |
Target: ernest.ns.cloudflare.com |
coolsailing.com | NS | 8879 |
Target: dora.ns.cloudflare.com |
coolsailing.com | SOA | 2657 |
MNAME: dora.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2032841040 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
coolsailing.com | MX | 300 |
Priority: 10 Target: mail2.skiset.com |
coolsailing.com | MX | 300 |
Priority: 5 Target: mail.skiset.com |
coolsailing.com | TXT | 300 |
TXT: ahrefs-site-verification_88c628cf5d1333d 6b1578d88ae294280a8a739730e383aa95e44def a6d2a2082 |
coolsailing.com | TXT | 300 |
TXT: ca3-339c69422fe242d2850d7b70bd1a3efa |
coolsailing.com | TXT | 300 |
TXT: v=spf1 ip4:94.23.45.126 ip4:87.252.2.18 a -all |
Similarly Ranked Websites
Landscaping Services In Mayfield Heights
- landscapingservicesinmayfieldheights.com
Landscaping services in Mayfield Heights provides lawn service, landscape design, lawn maintenance, and other forms of landscaping services.
8,708,716
$
8.95
Access denied | mazimsangare.xyz used Cloudflare to restrict access
- mazimsangare.xyz
8,708,747
$
240.00
IUCN SSC Anteater, Sloth and Armadillo Specialist Group | Here we shar
- xenarthrans.org
8,708,755
$
240.00
Full WHOIS Lookup
Domain Name: coolsailing.com
Registry Domain ID: 5428163_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ovh.com
Registrar URL: https://www.ovh.com
Updated Date: 2017-09-04T10:48:42.0Z
Creation Date: 1998-09-23T02:00:00.0Z
Registrar Registration Expiration Date: 2022-09-22T02:00:00.0Z
Registrar: OVH, SAS
Registrar IANA ID: 433
Registrar Abuse Contact Email: abuse@ovh.net
Registrar Abuse Contact Phone: +33.972101007
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: SKISET GROUPE - CLS
Registrant Street:
Registrant City:
Registrant State/Province:
Registrant Postal Code:
Registrant Country: FR
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: b7omkbuvubiqxn1kr2pz@e.o-w-o.info
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: kx8o764cskglhiokp130@z.o-w-o.info
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: kx8o764cskglhiokp130@z.o-w-o.info
Name Server: dora.ns.cloudflare.com
Name Server: ernest.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-09-01T03:47:03.0Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
###############################################################################
#
# Welcome to the OVH WHOIS Server.
#
# whois server : whois.ovh.com check server : check.ovh.com
#
# The data in this Whois is at your disposal with the aim of supplying you the
# information only, that is helping you in the obtaining of the information
# about or related to a domain name registration record. OVH Sas make this
# information available "as is", and do not guarantee its accuracy. By using
# Whois, you agree that you will use these data only for legal purposes and
# that, under no circumstances will you use this data to: (1) Allow, enable,
# or otherwise support the transmission of mass unsolicited, commercial
# advertisement or roughly or requests via the individual mail (courier),
# the E-mail (SPAM), by telephone or by fax. (2) Enable high volume, automated,
# electronic processes that apply to OVH Sas (or its computer systems).
# The copy, the compilation, the re-packaging, the dissemination or the
# other use of the Whois base is expressly forbidden without the prior
# written consent of OVH. Domain ownership disputes should be settled using
# ICANN's Uniform Dispute Resolution Policy: http://www.icann.org/udrp/udrp.htm
# We reserve the right to modify these terms at any time. By submitting
# this query, you agree to abide by these terms. OVH Sas reserves the right
# to terminate your access to the OVH Sas Whois database in its sole
# discretion, including without limitation, for excessive querying of
# the Whois database or for failure to otherwise abide by this policy.
#
# L'outil du Whois est à votre disposition dans le but de vous fournir
# l'information seulement, c'est-à-dire vous aider dans l'obtention de
# l'information sur ou lié à un rapport d'enregistrement de nom de domaine.
# OVH Sas rend cette information disponible "comme est," et ne garanti pas
# son exactitude. En utilisant notre outil Whois, vous reconnaissez que vous
# emploierez ces données seulement pour des buts légaux et ne pas utiliser cet
# outil dans les buts suivant: (1) la transmission de publicité non sollicitée,
# commerciale massive ou en gros ou des sollicitations via courrier individuel,
# le courrier électronique (c'est-à-dire SPAM), par téléphone ou par fax. (2)
# l'utilisation d'un grand volume, automatisé des processus électroniques qui
# soulignent ou chargent ce système de base de données Whois vous fournissant
# cette information. La copie de tout ou partie, la compilation, le
# re-emballage, la dissémination ou d'autre utilisation de la base Whois sont
# expressément interdits sans consentement écrit antérieur de OVH. Un désaccord
# sur la possession d'un nom de domaine peut être résolu en suivant la Uniform
# Dispute Resolution Policy de l'ICANN: http://www.icann.org/udrp/udrp.htm
# Nous nous réservons le droit de modifier ces termes à tout moment. En
# soumettant une requête au Whois vous consentez à vous soumettre à ces termes.
# local time : Friday, 20-Dec-19 04:48:54 UTC
# gmt time : Friday, 20-Dec-19 04:48:54 GMT
# last modify : Sunday, 01-Sep-19 03:35:04 UTC
# request from : 103.111.79.108:33257
Registry Domain ID: 5428163_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ovh.com
Registrar URL: https://www.ovh.com
Updated Date: 2017-09-04T10:48:42.0Z
Creation Date: 1998-09-23T02:00:00.0Z
Registrar Registration Expiration Date: 2022-09-22T02:00:00.0Z
Registrar: OVH, SAS
Registrar IANA ID: 433
Registrar Abuse Contact Email: abuse@ovh.net
Registrar Abuse Contact Phone: +33.972101007
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: SKISET GROUPE - CLS
Registrant Street:
Registrant City:
Registrant State/Province:
Registrant Postal Code:
Registrant Country: FR
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: b7omkbuvubiqxn1kr2pz@e.o-w-o.info
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: kx8o764cskglhiokp130@z.o-w-o.info
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: kx8o764cskglhiokp130@z.o-w-o.info
Name Server: dora.ns.cloudflare.com
Name Server: ernest.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-09-01T03:47:03.0Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
###############################################################################
#
# Welcome to the OVH WHOIS Server.
#
# whois server : whois.ovh.com check server : check.ovh.com
#
# The data in this Whois is at your disposal with the aim of supplying you the
# information only, that is helping you in the obtaining of the information
# about or related to a domain name registration record. OVH Sas make this
# information available "as is", and do not guarantee its accuracy. By using
# Whois, you agree that you will use these data only for legal purposes and
# that, under no circumstances will you use this data to: (1) Allow, enable,
# or otherwise support the transmission of mass unsolicited, commercial
# advertisement or roughly or requests via the individual mail (courier),
# the E-mail (SPAM), by telephone or by fax. (2) Enable high volume, automated,
# electronic processes that apply to OVH Sas (or its computer systems).
# The copy, the compilation, the re-packaging, the dissemination or the
# other use of the Whois base is expressly forbidden without the prior
# written consent of OVH. Domain ownership disputes should be settled using
# ICANN's Uniform Dispute Resolution Policy: http://www.icann.org/udrp/udrp.htm
# We reserve the right to modify these terms at any time. By submitting
# this query, you agree to abide by these terms. OVH Sas reserves the right
# to terminate your access to the OVH Sas Whois database in its sole
# discretion, including without limitation, for excessive querying of
# the Whois database or for failure to otherwise abide by this policy.
#
# L'outil du Whois est à votre disposition dans le but de vous fournir
# l'information seulement, c'est-à-dire vous aider dans l'obtention de
# l'information sur ou lié à un rapport d'enregistrement de nom de domaine.
# OVH Sas rend cette information disponible "comme est," et ne garanti pas
# son exactitude. En utilisant notre outil Whois, vous reconnaissez que vous
# emploierez ces données seulement pour des buts légaux et ne pas utiliser cet
# outil dans les buts suivant: (1) la transmission de publicité non sollicitée,
# commerciale massive ou en gros ou des sollicitations via courrier individuel,
# le courrier électronique (c'est-à-dire SPAM), par téléphone ou par fax. (2)
# l'utilisation d'un grand volume, automatisé des processus électroniques qui
# soulignent ou chargent ce système de base de données Whois vous fournissant
# cette information. La copie de tout ou partie, la compilation, le
# re-emballage, la dissémination ou d'autre utilisation de la base Whois sont
# expressément interdits sans consentement écrit antérieur de OVH. Un désaccord
# sur la possession d'un nom de domaine peut être résolu en suivant la Uniform
# Dispute Resolution Policy de l'ICANN: http://www.icann.org/udrp/udrp.htm
# Nous nous réservons le droit de modifier ces termes à tout moment. En
# soumettant une requête au Whois vous consentez à vous soumettre à ces termes.
# local time : Friday, 20-Dec-19 04:48:54 UTC
# gmt time : Friday, 20-Dec-19 04:48:54 GMT
# last modify : Sunday, 01-Sep-19 03:35:04 UTC
# request from : 103.111.79.108:33257