Coolsailing spécialiste de la location bateau, catamarans, voiliers, location bateaux moteur ou encore Yachts. Depuis 1998 nous proposons tout type de location de bateaux.

4.23 Rating by CuteStat

coolsailing.com is 2 decades 5 years old. It is a domain having com extension. It has a global traffic rank of #8708697 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, coolsailing.com is SAFE to browse.

PageSpeed Score
69
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 97
Daily Pageviews: 194

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 3,290
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 13,400
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 8,708,697
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

185.123.26.165

Hosted Country:

France FR

Location Latitude:

48.8543

Location Longitude:

2.3527
Location de bateaux avec ou sans skipper | Coolsailing CHARTER

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 11
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 20 Dec 2019 04:48:40 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-Cool-Cache: Fetch: Hit; route=home
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 20251
Content-Type: text/html; charset=UTF-8
Strict-Transport-Security: max-age=16000000; includeSubDomains; preload;
X-XSS-Protection: : 1;mode=block
X-Content-Type-Options: : nosniff
X-Frame-Options: SAMEORIGIN

Domain Information

Domain Registrar: OVH, SAS
Registration Date: Sep 23, 1998, 7:45 AM 2 decades 5 years 7 months ago
Expiration Date: Sep 22, 2022, 7:45 AM 1 year 7 months 1 week ago
Domain Status:
clientdeleteprohibited
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
dora.ns.cloudflare.com 172.64.32.108 United States of America United States of America
ernest.ns.cloudflare.com 173.245.59.164 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
coolsailing.com A 299 IP: 185.123.26.165
coolsailing.com NS 8879 Target: ernest.ns.cloudflare.com
coolsailing.com NS 8879 Target: dora.ns.cloudflare.com
coolsailing.com SOA 2657 MNAME: dora.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2032841040
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
coolsailing.com MX 300 Priority: 10
Target: mail2.skiset.com
coolsailing.com MX 300 Priority: 5
Target: mail.skiset.com
coolsailing.com TXT 300 TXT: ahrefs-site-verification_88c628cf5d1333d
6b1578d88ae294280a8a739730e383aa95e44def
a6d2a2082
coolsailing.com TXT 300 TXT: ca3-339c69422fe242d2850d7b70bd1a3efa
coolsailing.com TXT 300 TXT: v=spf1 ip4:94.23.45.126 ip4:87.252.2.18
a -all

Similarly Ranked Websites

Landscaping Services In Mayfield Heights

- landscapingservicesinmayfieldheights.com

Landscaping services in Mayfield Heights provides lawn service, landscape design, lawn maintenance, and other forms of landscaping services.

8,708,716 $ 8.95

Mayanst.com

- mayanst.com

اسم متجرك

8,708,737 $ 240.00

Chicane

- chicanemusic.com
8,708,746 $ 240.00


Full WHOIS Lookup

Domain Name: coolsailing.com
Registry Domain ID: 5428163_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ovh.com
Registrar URL: https://www.ovh.com
Updated Date: 2017-09-04T10:48:42.0Z
Creation Date: 1998-09-23T02:00:00.0Z
Registrar Registration Expiration Date: 2022-09-22T02:00:00.0Z
Registrar: OVH, SAS
Registrar IANA ID: 433
Registrar Abuse Contact Email: abuse@ovh.net
Registrar Abuse Contact Phone: +33.972101007
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: SKISET GROUPE - CLS
Registrant Street:
Registrant City:
Registrant State/Province:
Registrant Postal Code:
Registrant Country: FR
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: b7omkbuvubiqxn1kr2pz@e.o-w-o.info
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: kx8o764cskglhiokp130@z.o-w-o.info
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: kx8o764cskglhiokp130@z.o-w-o.info
Name Server: dora.ns.cloudflare.com
Name Server: ernest.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-09-01T03:47:03.0Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

###############################################################################
#
# Welcome to the OVH WHOIS Server.
#
# whois server : whois.ovh.com check server : check.ovh.com
#
# The data in this Whois is at your disposal with the aim of supplying you the
# information only, that is helping you in the obtaining of the information
# about or related to a domain name registration record. OVH Sas make this
# information available "as is", and do not guarantee its accuracy. By using
# Whois, you agree that you will use these data only for legal purposes and
# that, under no circumstances will you use this data to: (1) Allow, enable,
# or otherwise support the transmission of mass unsolicited, commercial
# advertisement or roughly or requests via the individual mail (courier),
# the E-mail (SPAM), by telephone or by fax. (2) Enable high volume, automated,
# electronic processes that apply to OVH Sas (or its computer systems).
# The copy, the compilation, the re-packaging, the dissemination or the
# other use of the Whois base is expressly forbidden without the prior
# written consent of OVH. Domain ownership disputes should be settled using
# ICANN's Uniform Dispute Resolution Policy: http://www.icann.org/udrp/udrp.htm
# We reserve the right to modify these terms at any time. By submitting
# this query, you agree to abide by these terms. OVH Sas reserves the right
# to terminate your access to the OVH Sas Whois database in its sole
# discretion, including without limitation, for excessive querying of
# the Whois database or for failure to otherwise abide by this policy.
#
# L'outil du Whois est à votre disposition dans le but de vous fournir
# l'information seulement, c'est-à-dire vous aider dans l'obtention de
# l'information sur ou lié à un rapport d'enregistrement de nom de domaine.
# OVH Sas rend cette information disponible "comme est," et ne garanti pas
# son exactitude. En utilisant notre outil Whois, vous reconnaissez que vous
# emploierez ces données seulement pour des buts légaux et ne pas utiliser cet
# outil dans les buts suivant: (1) la transmission de publicité non sollicitée,
# commerciale massive ou en gros ou des sollicitations via courrier individuel,
# le courrier électronique (c'est-à-dire SPAM), par téléphone ou par fax. (2)
# l'utilisation d'un grand volume, automatisé des processus électroniques qui
# soulignent ou chargent ce système de base de données Whois vous fournissant
# cette information. La copie de tout ou partie, la compilation, le
# re-emballage, la dissémination ou d'autre utilisation de la base Whois sont
# expressément interdits sans consentement écrit antérieur de OVH. Un désaccord
# sur la possession d'un nom de domaine peut être résolu en suivant la Uniform
# Dispute Resolution Policy de l'ICANN: http://www.icann.org/udrp/udrp.htm
# Nous nous réservons le droit de modifier ces termes à tout moment. En
# soumettant une requête au Whois vous consentez à vous soumettre à ces termes.

# local time : Friday, 20-Dec-19 04:48:54 UTC
# gmt time : Friday, 20-Dec-19 04:48:54 GMT
# last modify : Sunday, 01-Sep-19 03:35:04 UTC
# request from : 103.111.79.108:33257